Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FPR1 Peptide - middle region

FPR1 Peptide - middle region

Product Specifications

Product Name Alternative

FMLP, FPR

UniProt

P21462

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FPR1 Rabbit Polyclonal Antibody (orb585777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002020

Preservative

Lyophilized powder

AA Sequence

VACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FT (HIST3H3) Mouse Monoclonal Antibody [Clone ID: 10B2-6D2-4H4]
TA384421 100 µL

H3FT (HIST3H3) Mouse Monoclonal Antibody [Clone ID: 10B2-6D2-4H4]

Sign In for Pricing
View Details
P53 (Ab-33) Antibody
8B7182-AAT 50 µg

P53 (Ab-33) Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody
AP02537PU-N 100 µL

Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Kcna4 activation kit by CRISPRa
GA202247 1 Kit

Mouse Kcna4 activation kit by CRISPRa

Sign In for Pricing
View Details
Pneumocandin B0
TRC-P645300-50MG 50 mg

Pneumocandin B0

Sign In for Pricing
View Details
2-Bromophenetole
TRC-B686163-500MG 500 mg

2-Bromophenetole

Sign In for Pricing
View Details