Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - C-terminal region

CCKAR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1-R, CCKRA

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb331265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000721

Preservative

Lyophilized powder

AA Sequence

FEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Recombinant Nucleobindin 1 (NUCB1) ELISA Kit
YP-W100078-01 48 Tests

Human Recombinant Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
Human Recombinant Nucleobindin 1 (NUCB1) ELISA Kit
YP-W100078-02 96 Tests

Human Recombinant Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
STIP1 (HEL S 94n, IEF SSP 3521, Stress-induced-phosphoprotein 1) (FITC)
335952-01 50 µg

STIP1 (HEL S 94n, IEF SSP 3521, Stress-induced-phosphoprotein 1) (FITC)

Sign In for Pricing
View Details
STIP1 (HEL S 94n, IEF SSP 3521, Stress-induced-phosphoprotein 1) (FITC)
335952-02 100 µg

STIP1 (HEL S 94n, IEF SSP 3521, Stress-induced-phosphoprotein 1) (FITC)

Sign In for Pricing
View Details
Duoxa1-set siRNA/shRNA/RNAi Lentivector (Mouse)
18662094 4x 500 ng

Duoxa1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal UCH-L1/PGP9.5 Antibody (SPM574) [DyLight 594]
NBP2-34807DL594 0.1 mL

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (SPM574) [DyLight 594]

Sign In for Pricing
View Details