Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - C-terminal region

CCKAR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1-R, CCKRA

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb331265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000721

Preservative

Lyophilized powder

AA Sequence

FEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TFPI Antibody Picoband® (Biotine Conjugate)
PA1798-Biotin 100 µg/Vial

Anti-TFPI Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
SAMD13 (1-102, His-tag) Human Protein
AR50733PU-S 100 µg

SAMD13 (1-102, His-tag) Human Protein

Sign In for Pricing
View Details
OSGIN1 Antibody
orb1559855-01 50 µL

OSGIN1 Antibody

Sign In for Pricing
View Details
OSGIN1 Antibody
orb1559855-02 100 µL

OSGIN1 Antibody

Sign In for Pricing
View Details
OSGIN1 Antibody
orb1559855-03 200 µL

OSGIN1 Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor-basic Rat Recombinant (FGF 2 Rat)
PT_40013-01 10 µg

Fibroblast Growth Factor-basic Rat Recombinant (FGF 2 Rat)

Sign In for Pricing
View Details