Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Peptide - C-terminal region

DYRK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb585932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003574

Preservative

Lyophilized powder

AA Sequence

LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acp6 AAV siRNA Pooled Vector
11202164 1.0 µg

Acp6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IGHD Rabbit monoclonal antibody
BS40871-01 50 µL

IGHD Rabbit monoclonal antibody

Sign In for Pricing
View Details
IGHD Rabbit monoclonal antibody
BS40871-02 100 µL

IGHD Rabbit monoclonal antibody

Sign In for Pricing
View Details
MEMO1 Protein Vector (Human) (pPM-C-HA)
28351021 500 ng

MEMO1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human OR6F1 shRNA Plasmid
abx967424-01 150 µg

Human OR6F1 shRNA Plasmid

Sign In for Pricing
View Details
Human OR6F1 shRNA Plasmid
abx967424-02 300 µg

Human OR6F1 shRNA Plasmid

Sign In for Pricing
View Details