GPR3 Peptide - C-terminal region
GPR3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ACCA
UniProt
P46089
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR3 Rabbit Polyclonal Antibody (orb331274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005272
Preservative
Lyophilized powder
AA Sequence
PPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6486005-01 0.1 mL
MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (M
Sign In for Pricing
View Details MBS6486005-02 5x 0.1 mL
MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (M
Sign In for Pricing
View Details 
MBS1243995-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Trp operon repressor (trpR)
Sign In for Pricing
View Details MBS1243995-02 0.1 mg (E-Coli)
Recombinant Escherichia coli Trp operon repressor (trpR)
Sign In for Pricing
View Details MBS1243995-03 0.02 mg (Yeast)
Recombinant Escherichia coli Trp operon repressor (trpR)
Sign In for Pricing
View Details MBS1243995-04 0.1 mg (Yeast)
Recombinant Escherichia coli Trp operon repressor (trpR)
Sign In for Pricing
View Details