Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USO1 Peptide - C-terminal region

USO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P115, TAP, VDP

UniProt

O60763

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USO1 Rabbit Polyclonal Antibody (orb331287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003706

Preservative

Lyophilized powder

AA Sequence

QNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ly6g Recombinant Monoclonal Antibody
RAA00296-01 100 µL

Ly6g Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Ly6g Recombinant Monoclonal Antibody
RAA00296-02 200 µL

Ly6g Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
hsa-miR-3619-3p miRNA Inhibitor
MIH01944 2x 5.0 nmol

hsa-miR-3619-3p miRNA Inhibitor

Sign In for Pricing
View Details
Rabbit Monoclonal Transcription factor E3 Antibody (JE60-60)
NBP3-33005 100 µL

Rabbit Monoclonal Transcription factor E3 Antibody (JE60-60)

Sign In for Pricing
View Details
CFI-400437 HCl 100mg
A22463-100 100 mg

CFI-400437 HCl 100mg

Sign In for Pricing
View Details
ACOT1 Protein Vector (Mouse) (pPM-C-HA)
PV151776 500 ng

ACOT1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details