Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USO1 Peptide - C-terminal region

USO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P115, TAP, VDP

UniProt

O60763

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USO1 Rabbit Polyclonal Antibody (orb331287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003706

Preservative

Lyophilized powder

AA Sequence

QNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ω-Agatoxin IVa
4030173.01 0.1 mg

ω-Agatoxin IVa

Sign In for Pricing
View Details
CCDC160 (NM_001101357) Human Over-expression Lysate
LS347475-100ug 100 µg

CCDC160 (NM_001101357) Human Over-expression Lysate

Sign In for Pricing
View Details
APC mouse CD4 Antibody
orb3065646-01 25 Tests

APC mouse CD4 Antibody

Sign In for Pricing
View Details
APC mouse CD4 Antibody
orb3065646-02 100 Tests

APC mouse CD4 Antibody

Sign In for Pricing
View Details
Rat DNA-binding protein inhibitor ID-1,ID1 ELISA KIT
JOT-EK1949Ra-01 96 Well

Rat DNA-binding protein inhibitor ID-1,ID1 ELISA KIT

Sign In for Pricing
View Details
Rat DNA-binding protein inhibitor ID-1,ID1 ELISA KIT
JOT-EK1949Ra-02 48 Well

Rat DNA-binding protein inhibitor ID-1,ID1 ELISA KIT

Sign In for Pricing
View Details