Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL1 Peptide - N-terminal region

APOL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APO-L, APOL, APOL-I, FSGS4

UniProt

O14791

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL1 Rabbit Polyclonal Antibody (orb331002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003652

Preservative

Lyophilized powder

AA Sequence

AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRTN Antibody
KC-27290-01 50 μL

NRTN Antibody

Sign In for Pricing
View Details
NRTN Antibody
KC-27290-02 100 µL

NRTN Antibody

Sign In for Pricing
View Details
NRTN Antibody
KC-27290-03 1 mL

NRTN Antibody

Sign In for Pricing
View Details
Guinea Pig IgG (H&L) Antibody Rhodamine Conjugated Pre-Adsorbed
TA397677 1 mg

Guinea Pig IgG (H&L) Antibody Rhodamine Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
SEN1 (MORF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]
TA800383AM 100 µL

SEN1 (MORF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]

Sign In for Pricing
View Details
L-Arginine (L-Arg) Colorimetric Assay Kit
E-BC-K850-M 96 T (40 samples)

L-Arginine (L-Arg) Colorimetric Assay Kit

Sign In for Pricing
View Details