Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL1 Peptide - N-terminal region

APOL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APO-L, APOL, APOL-I, FSGS4

UniProt

O14791

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL1 Rabbit Polyclonal Antibody (orb331002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003652

Preservative

Lyophilized powder

AA Sequence

AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse GITR/TNFRSF18 Protein (Fc & His Tag)
PKSM041029-01 10 µg

Recombinant Mouse GITR/TNFRSF18 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Mouse GITR/TNFRSF18 Protein (Fc & His Tag)
PKSM041029-02 50 µg

Recombinant Mouse GITR/TNFRSF18 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD172a/SIRPα Antibody[P84]
E-AB-F1286UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD172a/SIRPα Antibody[P84]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD172a/SIRPα Antibody[P84]
E-AB-F1286UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD172a/SIRPα Antibody[P84]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091,  10nm
GM-201-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091, 10nm

Sign In for Pricing
View Details
Wdr54 Mouse Gene Knockout Kit (CRISPR)
KN519369 1 Kit

Wdr54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details