Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD109 Peptide - middle region

CD109 Peptide - middle region

Product Specifications

Product Name Alternative

CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1

UniProt

Q6YHK3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD109 Rabbit Polyclonal Antibody (orb585874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153060

Preservative

Lyophilized powder

AA Sequence

KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC1 Antibody
KC-1785-01 50 μL

ERCC1 Antibody

Sign In for Pricing
View Details
ERCC1 Antibody
KC-1785-02 100 µL

ERCC1 Antibody

Sign In for Pricing
View Details
ERCC1 Antibody
KC-1785-03 1 mL

ERCC1 Antibody

Sign In for Pricing
View Details
Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit
MBS9318776-01 48 Well

Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit

Sign In for Pricing
View Details
Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit
MBS9318776-02 96 Well

Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit

Sign In for Pricing
View Details
Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit
MBS9318776-03 5x 96 Well

Bovine Suppressor of cytokine signaling 5, SOCS5 ELISA Kit

Sign In for Pricing
View Details