Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD109 Peptide - middle region

CD109 Peptide - middle region

Product Specifications

Product Name Alternative

CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1

UniProt

Q6YHK3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD109 Rabbit Polyclonal Antibody (orb585874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153060

Preservative

Lyophilized powder

AA Sequence

KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein
abx651495-01 50 µg

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein
abx651495-02 100 µg

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein
abx651495-03 200 µg

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein
abx651495-04 500 µg

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein
abx651495-05 1 mg

Mouse C-X-C Motif Chemokine 2 (CXCL2) Protein

Sign In for Pricing
View Details
Mouse Mtmr4 activation kit by CRISPRa
GA212593 1 Kit

Mouse Mtmr4 activation kit by CRISPRa

Sign In for Pricing
View Details