JMY Peptide - N-terminal region
JMY Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ37870, MGC163496, WHDC1L3
UniProt
Q8N9B5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with JMY Rabbit Polyclonal Antibody (orb586075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689618
Preservative
Lyophilized powder
AA Sequence
VFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEAGGAASDGSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
L2030-30-ML550 100 µL
LSP1 (Lymphocyte-specific Protein 1, 47kD Actin-binding Protein, 52kD Phosphoprotein, pp52, Lymphocyte-specific Antigen WP34, WP34) (MaxLight 550)
Sign In for Pricing
View Details TA803536AM 100 µL
C11ORF67 (AAMDC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C1]
Sign In for Pricing
View Details 