JMY Peptide - N-terminal region
JMY Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ37870, MGC163496, WHDC1L3
UniProt
Q8N9B5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with JMY Rabbit Polyclonal Antibody (orb586075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689618
Preservative
Lyophilized powder
AA Sequence
VFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEAGGAASDGSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
28281124 3x 1.0µg DNA
MEAF6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details 
MBS1296428-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM)
Sign In for Pricing
View Details MBS1296428-02 0.02 mg (Yeast)
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM)
Sign In for Pricing
View Details MBS1296428-03 0.1 mg (E-Coli)
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM)
Sign In for Pricing
View Details MBS1296428-04 0.1 mg (Yeast)
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM)
Sign In for Pricing
View Details MBS1296428-05 0.02 mg (Baculovirus)
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM)
Sign In for Pricing
View Details