Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - C-terminal region

STC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb585882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003705

Preservative

Lyophilized powder

AA Sequence

PSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal BACE-1 Antibody (027) [Allophycocyanin]
NBP2-89254APC 0.1 mL

Rabbit Monoclonal BACE-1 Antibody (027) [Allophycocyanin]

Sign In for Pricing
View Details
TLR4 (NM_138554) Human Over-expression Lysate
LC408575 20 µg

TLR4 (NM_138554) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Calsyntenin-1 Antibody [DyLight 680]
NBP2-99468FR 0.1 mL

Rabbit Polyclonal Calsyntenin-1 Antibody [DyLight 680]

Sign In for Pricing
View Details
GFP Tag Antibody (Ascites)
orb652213-01 50 μL

GFP Tag Antibody (Ascites)

Sign In for Pricing
View Details
GFP Tag Antibody (Ascites)
orb652213-02 100 µL

GFP Tag Antibody (Ascites)

Sign In for Pricing
View Details
Protein Kinase C Zeta Type (PRKCZ) Antibody
abx455845-01 50 µg

Protein Kinase C Zeta Type (PRKCZ) Antibody

Sign In for Pricing
View Details