Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - C-terminal region

STC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb585882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003705

Preservative

Lyophilized powder

AA Sequence

PSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF146 Antibody [DyLight 488]
NBP2-97822G 0.1 mL

Rabbit Polyclonal ZNF146 Antibody [DyLight 488]

Sign In for Pricing
View Details
STAM2 (NM_005843) Human Tagged Lenti ORF Clone
RC206279L1 10 µg

STAM2 (NM_005843) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PYK2 (2Q16) Rabbit Monoclonal Antibody
E28M0237 100 µL

PYK2 (2Q16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Kcnip3 Mouse Gene Knockout Kit (CRISPR)
KN508646 1 Kit

Kcnip3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-[3-Chloro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl]pyrrolidine
OR1087777-01 250 mg

1-[3-Chloro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl]pyrrolidine

Sign In for Pricing
View Details
1-[3-Chloro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl]pyrrolidine
OR1087777-02 500 mg

1-[3-Chloro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl]pyrrolidine

Sign In for Pricing
View Details