Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND2 Peptide - C-terminal region

RND2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARHN, RHO7, RhoN

UniProt

P52198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RND2 Rabbit Polyclonal Antibody (orb586049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005431

Preservative

Lyophilized powder

AA Sequence

TVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque TNF RII (C-Fc)
C05F-10ug 10 µg

Recombinant Rhesus Macaque TNF RII (C-Fc)

Sign In for Pricing
View Details
Rpl3 AAV siRNA Pooled Vector
41330164 1.0 µg

Rpl3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NAT10 Rabbit Polyclonal Antibody (BF594)
orb2390465 100 µL

NAT10 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
SERCA2 Polyclonal Antibody
MBS8526432-01 0.1 mg

SERCA2 Polyclonal Antibody

Sign In for Pricing
View Details
SERCA2 Polyclonal Antibody
MBS8526432-02 0.1 mL (AF635)

SERCA2 Polyclonal Antibody

Sign In for Pricing
View Details
SERCA2 Polyclonal Antibody
MBS8526432-03 0.1 mL (AF610)

SERCA2 Polyclonal Antibody

Sign In for Pricing
View Details