TACR3 Peptide - C-terminal region
TACR3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC148060, MGC148061, NK3R, TAC3RL, NKR, NK-3R
UniProt
P29371
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TACR3 Rabbit Polyclonal Antibody (orb586038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001050
Preservative
Lyophilized powder
AA Sequence
NDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY423636 100 µg
MIR99AHG (NM_001005733) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC422382 20 µg
HSPC142 (BABAM1) (NM_001033549) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC941791-100 1x 100 µL
SOX2 (Transcription Factor) (SOX2/1791), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 