Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMFB Peptide - middle region

GMFB Peptide - middle region

Product Specifications

Product Name Alternative

GMF

UniProt

Q5R6P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMFB Rabbit Polyclonal Antibody (orb586151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004115

Preservative

Lyophilized powder

AA Sequence

ELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf114 (CCDC181) Human Gene Knockout Kit (CRISPR)
KN420527 1 Kit

C1orf114 (CCDC181) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MROH2A Antibody
KC-22329-01 50 μL

MROH2A Antibody

Sign In for Pricing
View Details
MROH2A Antibody
KC-22329-02 100 µL

MROH2A Antibody

Sign In for Pricing
View Details
MROH2A Antibody
KC-22329-03 1 mL

MROH2A Antibody

Sign In for Pricing
View Details
Human STOX1 activation kit by CRISPRa
GA116510 1 Kit

Human STOX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ALG14 activation kit by CRISPRa
GA116321 1 Kit

Human ALG14 activation kit by CRISPRa

Sign In for Pricing
View Details