Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMFB Peptide - middle region

GMFB Peptide - middle region

Product Specifications

Product Name Alternative

GMF

UniProt

Q5R6P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMFB Rabbit Polyclonal Antibody (orb586151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004115

Preservative

Lyophilized powder

AA Sequence

ELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine TIGIT Protein, His Tag (MALS verified)
TIT-C52H7-100ug 100 µg

Canine TIGIT Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS517937 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Lin28B Recombinant Rabbit Monoclonal Antibody [JE04-80]
HA722688 100 µL

Lin28B Recombinant Rabbit Monoclonal Antibody [JE04-80]

Sign In for Pricing
View Details
IL32 Rabbit Polyclonal Antibody
TA368250 100 µL

IL32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CoREST (RCOR1) Human Gene Knockout Kit (CRISPR)
KN424027 1 Kit

CoREST (RCOR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Acetamidobenzene-d4-sulfonyl Chloride
TRC-A170951-250MG 250 mg

4-Acetamidobenzene-d4-sulfonyl Chloride

Sign In for Pricing
View Details