Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL2RB Peptide - C-terminal region

IL2RB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD122, P70-75, IL15RB

UniProt

P14784

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL2RB Rabbit Polyclonal Antibody (orb331125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000869

Preservative

Lyophilized powder

AA Sequence

QGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine-d5
TRC-G615992-10MG 10 mg

Glycine-d5

Sign In for Pricing
View Details
3,3'-Diisopropylbiphenyl
TRC-D499845-250MG 250 mg

3,3'-Diisopropylbiphenyl

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800070 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CPEB2 Human qPCR Primer Pair (NM_182485)
HP219044 200 Reactions

CPEB2 Human qPCR Primer Pair (NM_182485)

Sign In for Pricing
View Details
Rat Coagulation Factor X (F10) ELISA Kit
RD-F10-Ra-01 96 Tests

Rat Coagulation Factor X (F10) ELISA Kit

Sign In for Pricing
View Details
Rat Coagulation Factor X (F10) ELISA Kit
RD-F10-Ra-02 48 Tests

Rat Coagulation Factor X (F10) ELISA Kit

Sign In for Pricing
View Details