IL2RB Peptide - C-terminal region
IL2RB Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD122, P70-75, IL15RB
UniProt
P14784
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL2RB Rabbit Polyclonal Antibody (orb331125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000869
Preservative
Lyophilized powder
AA Sequence
QGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-AB-V1283-01 20 µL
Anti-MERS-CoV Nucleocapsid Protein Polyclonal Antibody
Sign In for Pricing
View Details E-AB-V1283-02 100 µL
Anti-MERS-CoV Nucleocapsid Protein Polyclonal Antibody
Sign In for Pricing
View Details 
BNC681868-500 1x 500 µL
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
