Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNL1 Peptide - C-terminal region

TXNL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP32, TXL-1, TXNL, Txl

UniProt

O43396

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXNL1 Rabbit Polyclonal Antibody (orb586128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004777

Preservative

Lyophilized powder

AA Sequence

PRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Golgin 97 Antibody
H00002800-D01P 0.1 mg

Rabbit Polyclonal Golgin 97 Antibody

Sign In for Pricing
View Details
FAM131A cDNA Clone
MBS1271525-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

FAM131A cDNA Clone

Sign In for Pricing
View Details
FAM131A cDNA Clone
MBS1271525-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

FAM131A cDNA Clone

Sign In for Pricing
View Details
TLR2 Biosimilar Antibody
orb2670786 100 Tests

TLR2 Biosimilar Antibody

Sign In for Pricing
View Details
PKIB (NM_181795) Human Over-expression Lysate
LC405588 20 µg

PKIB (NM_181795) Human Over-expression Lysate

Sign In for Pricing
View Details
PAQR3 sgRNA CRISPR Lentivector set (Human)
K1593301 3x 1.0 µg

PAQR3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details