Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNL1 Peptide - C-terminal region

TXNL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP32, TXL-1, TXNL, Txl

UniProt

O43396

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXNL1 Rabbit Polyclonal Antibody (orb586128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004777

Preservative

Lyophilized powder

AA Sequence

PRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit
MBS085349-01 48 Well

Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit

Sign In for Pricing
View Details
Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit
MBS085349-02 96 Well

Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit

Sign In for Pricing
View Details
Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit
MBS085349-03 5x 96 Well

Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit

Sign In for Pricing
View Details
Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit
MBS085349-04 10x 96 Well

Hamster N-Acetyl Alpha-D-Glucosaminidase ELISA Kit

Sign In for Pricing
View Details
Anti-BRCA1 Antibody Picoband®
PB9015 100 µg/Vial

Anti-BRCA1 Antibody Picoband®

Sign In for Pricing
View Details
SALL4
PR398-3ml 3 mL

SALL4

Sign In for Pricing
View Details