Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creg1 Peptide - C-terminal region

Creg1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA755314, Creg

UniProt

O88668

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Creg1 Rabbit Polyclonal Antibody (orb576656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035934

Preservative

Lyophilized powder

AA Sequence

MMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Monoclonal Antibody
BT-MCA3846-01 50 µL

CD163 Monoclonal Antibody

Sign In for Pricing
View Details
CD163 Monoclonal Antibody
BT-MCA3846-02 100 µL

CD163 Monoclonal Antibody

Sign In for Pricing
View Details
Cyp2c54 Recombinant Protein (Mouse)
RP127163 100 µg

Cyp2c54 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
2-Pyridin-4-yl-2,3-dihydro-1H-quinazolin-4-one
sc-308651 500 mg

2-Pyridin-4-yl-2,3-dihydro-1H-quinazolin-4-one

Sign In for Pricing
View Details
pWPXLd-Flag-SENP3 Plasmid
PVTB00472-4a 2 µg

pWPXLd-Flag-SENP3 Plasmid

Sign In for Pricing
View Details
DTNB Rabbit pAb, PE-Cy7 conjugated
orb2865715 100 µL

DTNB Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details