Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd1 Peptide - C-terminal region

Ankrd1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Alrp, Carp|Crap

UniProt

Q8R560

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankrd1 Rabbit Polyclonal Antibody (orb580373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037352

Preservative

Lyophilized powder

AA Sequence

VAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTF

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP22 Protein Vector (Mouse) (pPB-N-His)
PV173735 500 ng

DUSP22 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
POTB7-NMT1
PPL01920-1 1 Each

POTB7-NMT1

Sign In for Pricing
View Details
Human Desmocollin 3 (DSC3) ELISA Kit
DLR-DSC3-Hu-48T 48 Tests

Human Desmocollin 3 (DSC3) ELISA Kit

Sign In for Pricing
View Details
TTYH1 Protein Vector (Mouse) (pPB-C-His)
PV242934 500 ng

TTYH1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ZN681 rabbit pAb
MBS8600819-01 0.1 mL

ZN681 rabbit pAb

Sign In for Pricing
View Details
ZN681 rabbit pAb
MBS8600819-02 0.1 mL (AF405L)

ZN681 rabbit pAb

Sign In for Pricing
View Details