Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd1 Peptide - C-terminal region

Ankrd1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Alrp, Carp|Crap

UniProt

Q8R560

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankrd1 Rabbit Polyclonal Antibody (orb580373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037352

Preservative

Lyophilized powder

AA Sequence

VAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTF

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSM-beta
MBS5818496 Inquire

PSM-beta

Sign In for Pricing
View Details
JIP2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13647R-APC-Cy5.5 100 µL

JIP2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
N-[ (Naphthalen-1-yl) methyl]guanidine hydrochloride
GAA04771-01 50 mg

N-[ (Naphthalen-1-yl) methyl]guanidine hydrochloride

Sign In for Pricing
View Details
N-[ (Naphthalen-1-yl) methyl]guanidine hydrochloride
GAA04771-02 0.5 g

N-[ (Naphthalen-1-yl) methyl]guanidine hydrochloride

Sign In for Pricing
View Details
Recombinant Human COIL Protein
E30P00365D 50 µg

Recombinant Human COIL Protein

Sign In for Pricing
View Details
Human Persephin (PSPN) ELISA Kit
RD-PSPN-Hu-01 96 Tests

Human Persephin (PSPN) ELISA Kit

Sign In for Pricing
View Details