Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INHBC Peptide - N-terminal region

INHBC Peptide - N-terminal region

Product Specifications

Product Name Alternative

IHBC

UniProt

P55103

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INHBC Rabbit Polyclonal Antibody (orb586120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005529

Preservative

Lyophilized powder

AA Sequence

QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal DDX3 / DDX3X Antibody (N-Terminus)
APR02494G 0.05mg

Polyclonal DDX3 / DDX3X Antibody (N-Terminus)

Sign In for Pricing
View Details
BPI (NM_001725) Human Over-expression Lysate
LS000671-100ug 100 µg

BPI (NM_001725) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) DHAR1 Polyclonal Antibody
MBS9007477 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) DHAR1 Polyclonal Antibody

Sign In for Pricing
View Details
RBPMS antibody
70R-4899 100 µL

RBPMS antibody

Sign In for Pricing
View Details
1-Bromo-3-fluoropropane discontinued
409249-01 100 mg

1-Bromo-3-fluoropropane discontinued

Sign In for Pricing
View Details
1-Bromo-3-fluoropropane discontinued
409249-02 250 mg

1-Bromo-3-fluoropropane discontinued

Sign In for Pricing
View Details