Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INHBC Peptide - N-terminal region

INHBC Peptide - N-terminal region

Product Specifications

Product Name Alternative

IHBC

UniProt

P55103

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INHBC Rabbit Polyclonal Antibody (orb586120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005529

Preservative

Lyophilized powder

AA Sequence

QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RNGTT Antibody [HRP]
NBP2-97837H 0.1 mL

Rabbit Polyclonal RNGTT Antibody [HRP]

Sign In for Pricing
View Details
Interleukin-21 Human Recombinant
rAP-0584 1 Each

Interleukin-21 Human Recombinant

Sign In for Pricing
View Details
Mxd3 Rat siRNA Oligo Duplex (Locus ID 252915)
SR507918 1 Kit

Mxd3 Rat siRNA Oligo Duplex (Locus ID 252915)

Sign In for Pricing
View Details
LCN1 Antibody - middle region
ARP54685_P050-25UL 25 µL

LCN1 Antibody - middle region

Sign In for Pricing
View Details
Mbd1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6383904 1.0 µg DNA

Mbd1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Prolactin-inducible protein
orb1638057-01 50 µg

Prolactin-inducible protein

Sign In for Pricing
View Details