Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML1 Peptide - C-terminal region

TREML1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLTL1825, MGC119173, PRO3438, TLT-1, TLT1, dJ238O23.3

UniProt

Q86YW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREML1 Rabbit Polyclonal Antibody (orb331313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835468

Preservative

Lyophilized powder

AA Sequence

PSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Descyano-2-ethyl Formyl-tofacitinib
TRC-D221590-50MG 50 mg

2-Descyano-2-ethyl Formyl-tofacitinib

Sign In for Pricing
View Details
Phospho-ErbB2 Antibody (pY1140)
F48697-0.4ML 0.4 mL

Phospho-ErbB2 Antibody (pY1140)

Sign In for Pricing
View Details
Slc2a5 Mouse Gene Knockout Kit (CRISPR)
KN516032 1 Kit

Slc2a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAD-Hexylamine, Lithium Salt
#10064 1x 1 mg

NAD-Hexylamine, Lithium Salt

Sign In for Pricing
View Details
Wide Bore Pipette Tip
P5740 960 Units/Pack

Wide Bore Pipette Tip

Sign In for Pricing
View Details
Recombinant DHRS1 Antibody
RC-4635-01 50 μL

Recombinant DHRS1 Antibody

Sign In for Pricing
View Details