Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAGE2A Peptide - C-terminal region

GAGE2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT4.2, GAGE2, GAGE2B, MGC96883, MGC96930, MGC96942

UniProt

Q6NT46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAGE2A Rabbit Polyclonal Antibody (orb586116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120684

Preservative

Lyophilized powder

AA Sequence

GQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF protein, Human, Recombinant (His)
E51P91525 20 µg

HGF protein, Human, Recombinant (His)

Sign In for Pricing
View Details
9830107B12Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10903094 4x 500 ng

9830107B12Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
APEH Protein Vector (Mouse) (pPM-C-HA)
12139024 500 ng

APEH Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Bovine Protein CASC3 (CASC3) , partial
MBS1021731 Inquire

Recombinant Bovine Protein CASC3 (CASC3) , partial

Sign In for Pricing
View Details
ABCF1 Polyclonal Antibody, PE Conjugated
bs-1960R-PE 100 µL

ABCF1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Lentiviral human CHP1 shRNA (UAS) - Lentiviral human CHP1 shRNA (UAS, GFP) plasmid
GTR15144694 1 Vial

Lentiviral human CHP1 shRNA (UAS) - Lentiviral human CHP1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details