Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAGE2A Peptide - C-terminal region

GAGE2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT4.2, GAGE2, GAGE2B, MGC96883, MGC96930, MGC96942

UniProt

Q6NT46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAGE2A Rabbit Polyclonal Antibody (orb586116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120684

Preservative

Lyophilized powder

AA Sequence

GQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGRP Antibody
A74751-50UL 50 μL

AGRP Antibody

Sign In for Pricing
View Details
ZNF177 Polyclonal Conjugated Antibody
C28709 100 µL

ZNF177 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)
MBS1099486-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)
MBS1099486-02 0.1 mg (E-Coli)

Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)
MBS1099486-03 0.02 mg (Yeast)

Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)
MBS1099486-04 0.1 mg (Yeast)

Recombinant Desulfovibrio vulgaris Octanoyltransferase (lipB)

Sign In for Pricing
View Details