What is the catalog number for HCG9 Peptide - N-terminal region?

The catalog number for HCG9 Peptide - N-terminal region is orb2007368.

What sizes are available for HCG9 Peptide - N-terminal region?

HCG9 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is HCG9 Peptide - N-terminal region in stock?

HCG9 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

HCG9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HCGIX, HCGIX4

UniProt

Q93065

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005835

Preservative

Lyophilized powder

AA Sequence

GWEQSQEESSAWSRQAPTPQLESQEPHSPHSNRKHQLLVPKKGGPQLQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-34564MFV500 0.1 mL

Mouse Monoclonal CD45RB Antibody (BRA-11 (same as BRA-11G)) [mFluor Violet 500 SE]

Sign In for Pricing

View Details

orb2827697 100 µL

PDGF-D/SCDGFB Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing

View Details

MBS535630-01 0.05 mg

NANP antibody

Sign In for Pricing

View Details

MBS535630-02 5x 0.05 mg

NANP antibody

Sign In for Pricing

View Details

PV042118 500 ng

TIMM8A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing

View Details

TMAB-02007-01 1 mg

Donkey Anti-Rabbit IgG H&L Secondary Antibody

Sign In for Pricing

View Details