Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkar1a Peptide - N-terminal region

Prkar1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIIA

UniProt

P09456

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prkar1a Rabbit Polyclonal Antibody (orb583735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037313

Preservative

Lyophilized powder

AA Sequence

REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCCAG1 Lentiviral Activation Particles (h2)
sc-411248-LAC-2 200 µL

SDCCAG1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Lrch4 Rat shRNA Plasmid (Locus ID 360779)
TR708425 1 Kit

Lrch4 Rat shRNA Plasmid (Locus ID 360779)

Sign In for Pricing
View Details
HSPB7 shRNA (m) Lentiviral Particles
sc-105547-V 200 µL

HSPB7 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
GNAS Polyclonal Antibody
bs-3939R-01 20 µL

GNAS Polyclonal Antibody

Sign In for Pricing
View Details
GNAS Polyclonal Antibody
bs-3939R-02 100 µL

GNAS Polyclonal Antibody

Sign In for Pricing
View Details
AP1S3 Human qPCR Primer Pair (NM_001039569)
HP203310 200 Reactions

AP1S3 Human qPCR Primer Pair (NM_001039569)

Sign In for Pricing
View Details