Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkar1a Peptide - N-terminal region

Prkar1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIIA

UniProt

P09456

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prkar1a Rabbit Polyclonal Antibody (orb583735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037313

Preservative

Lyophilized powder

AA Sequence

REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TH Recombinant Monoclonal Antibody
RAC08591-01 50 µL

TH Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
TH Recombinant Monoclonal Antibody
RAC08591-02 100 µL

TH Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
4- (4-nitrophenoxy) -1,1'-biphenyl
OR1093355 1 Each

4- (4-nitrophenoxy) -1,1'-biphenyl

Sign In for Pricing
View Details
SVOPL Human shRNA Plasmid Kit (Locus ID 136306)
TR307769 1 Kit

SVOPL Human shRNA Plasmid Kit (Locus ID 136306)

Sign In for Pricing
View Details
Gm5127 (NM_001033541) Mouse Tagged ORF Clone
MR212832 10 µg

Gm5127 (NM_001033541) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GPR48 Rabbit Polyclonal Antibody (BF750)
orb1597905 100 µL

GPR48 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details