Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5 Peptide - N-terminal region

NUDT5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

YSA1, YSA1H, hYSAH1

UniProt

Q9UKK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT5 Rabbit Polyclonal Antibody (orb586265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054861

Preservative

Lyophilized powder

AA Sequence

EKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS8 Antibody
8C14126-AAT 50 µg

RPS8 Antibody

Sign In for Pricing
View Details
Human E1A Binding Protein P300 (EP300) ELISA Kit
RD-EP300-Hu-01 96 Tests

Human E1A Binding Protein P300 (EP300) ELISA Kit

Sign In for Pricing
View Details
Human E1A Binding Protein P300 (EP300) ELISA Kit
RD-EP300-Hu-02 48 Tests

Human E1A Binding Protein P300 (EP300) ELISA Kit

Sign In for Pricing
View Details
ADAM2 Rabbit Polyclonal Antibody
TA362045 100 µL

ADAM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(4-Nitro-1-oxoisoindolin-2-yl)pentanedioic Acid
TRC-N496903-10MG 10 mg

2-(4-Nitro-1-oxoisoindolin-2-yl)pentanedioic Acid

Sign In for Pricing
View Details
Basic Water Purification System BBPS-501
BBPS-501 1 Unit

Basic Water Purification System BBPS-501

Sign In for Pricing
View Details