CHMP6 Peptide - middle region
CHMP6 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ11749, VPS20
UniProt
Q96FZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHMP6 Rabbit Polyclonal Antibody (orb586280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078867
Preservative
Lyophilized powder
AA Sequence
VMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP61209_P050-Biotin 100 µL
VASP Antibody - C-terminal region : Biotin (ARP61209_P050-Biotin)
Sign In for Pricing
View Details 
GTR10349719 96 Well
Sheep LYR motif containing protein 7 (LYRM7) ELISA Kit
Sign In for Pricing
View Details 
138335 100 µg
SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE)
Sign In for Pricing
View Details 
QS2991Hu-01 48 Tests
Quick Step Human Chitinase 1 (CHIT1) ELISA Kit
Sign In for Pricing
View Details