Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP6 Peptide - middle region

CHMP6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11749, VPS20

UniProt

Q96FZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHMP6 Rabbit Polyclonal Antibody (orb586280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078867

Preservative

Lyophilized powder

AA Sequence

VMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIR3DL3/CD158z Alexa Fluor 647 MAb (Clone 1136B)
FAB8919R-100 100 Tests

Human KIR3DL3/CD158z Alexa Fluor 647 MAb (Clone 1136B)

Sign In for Pricing
View Details
Anti-CD20 Antibody-PE/Cy7 labled
MBS8321823-01 25 Assays

Anti-CD20 Antibody-PE/Cy7 labled

Sign In for Pricing
View Details
Anti-CD20 Antibody-PE/Cy7 labled
MBS8321823-02 100 Assays

Anti-CD20 Antibody-PE/Cy7 labled

Sign In for Pricing
View Details
Anti-CD20 Antibody-PE/Cy7 labled
MBS8321823-03 5x 100 Assays

Anti-CD20 Antibody-PE/Cy7 labled

Sign In for Pricing
View Details
Rabbit Polyclonal Semaphorin 3A Antibody
NBP1-84409 0.1 mL

Rabbit Polyclonal Semaphorin 3A Antibody

Sign In for Pricing
View Details
IL-1RAcP (D-5) Alexa Fluor® 594
sc-376872 AF594 200 µg/mL

IL-1RAcP (D-5) Alexa Fluor® 594

Sign In for Pricing
View Details