Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK3 Peptide - C-terminal region

HOOK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ31058, HK3

UniProt

Q86VS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOOK3 Rabbit Polyclonal Antibody (orb586316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115786

Preservative

Lyophilized powder

AA Sequence

LFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF585A Rabbit Polyclonal Antibody
orb3071733-01 30 µL

ZNF585A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF585A Rabbit Polyclonal Antibody
orb3071733-02 50 µL

ZNF585A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF585A Rabbit Polyclonal Antibody
orb3071733-03 100 µL

ZNF585A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF585A Rabbit Polyclonal Antibody
orb3071733-04 200 µL

ZNF585A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Gys1 Pre-designed siRNA Set A
SI206049A 1 Each

Rat Gys1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1194430-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details