Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCNM1 Peptide - C-terminal region

SCNM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC3180

UniProt

Q9BWG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCNM1 Rabbit Polyclonal Antibody (orb586328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076946

Preservative

Lyophilized powder

AA Sequence

EVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig TPS (Tryptase) ELISA Kit
MBS8806837-01 48 Well

Pig TPS (Tryptase) ELISA Kit

Sign In for Pricing
View Details
Pig TPS (Tryptase) ELISA Kit
MBS8806837-02 96 Well

Pig TPS (Tryptase) ELISA Kit

Sign In for Pricing
View Details
Pig TPS (Tryptase) ELISA Kit
MBS8806837-03 5x 96 Well

Pig TPS (Tryptase) ELISA Kit

Sign In for Pricing
View Details
Pig TPS (Tryptase) ELISA Kit
MBS8806837-04 10x 96 Well

Pig TPS (Tryptase) ELISA Kit

Sign In for Pricing
View Details
LTA4H Rabbit Polyclonal Antibody (BF405)
orb2444106 100 µL

LTA4H Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Anti-Transmissible Gastroenteritis Virus Antibody
18001 100ug

Anti-Transmissible Gastroenteritis Virus Antibody

Sign In for Pricing
View Details