Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCNM1 Peptide - C-terminal region

SCNM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC3180

UniProt

Q9BWG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCNM1 Rabbit Polyclonal Antibody (orb586328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076946

Preservative

Lyophilized powder

AA Sequence

EVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99
TRC-E941100-500MG 500 mg

1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99

Sign In for Pricing
View Details
Recombinant human NUDT1/MTH1 protein
ATGP0742-020 20 µg

Recombinant human NUDT1/MTH1 protein

Sign In for Pricing
View Details
Wtap Mouse shRNA Plasmid (Locus ID 60532)
TL512253 1 Kit

Wtap Mouse shRNA Plasmid (Locus ID 60532)

Sign In for Pricing
View Details
Mouse Monoclonal CD7 Antibody (MEM-186) [mFluor Violet 450 SE]
NB500-326MFV450 0.1 mL

Mouse Monoclonal CD7 Antibody (MEM-186) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
LRG1 Adenovirus (Rat)
27592056 1.0 mL

LRG1 Adenovirus (Rat)

Sign In for Pricing
View Details
TS (TS 106) Alexa Fluor® 488
sc-33679 AF488 200 µg/mL

TS (TS 106) Alexa Fluor® 488

Sign In for Pricing
View Details