GPRC6A Peptide - N-terminal region
GPRC6A Peptide - N-terminal region
Product Specifications
Product Name Alternative
GPCR, bA86F4.3
UniProt
Q5T6X5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPRC6A Rabbit Polyclonal Antibody (orb331279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_683766
Preservative
Lyophilized powder
AA Sequence
SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-8012-40 1 mL
Colloidal Gold Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-, 40nm
Sign In for Pricing
View Details 
BNC681604-100 1x 100 µL
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472598-100 1x 100 µL
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
