GPRC6A Peptide - N-terminal region
GPRC6A Peptide - N-terminal region
Product Specifications
Product Name Alternative
GPCR, bA86F4.3
UniProt
Q5T6X5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPRC6A Rabbit Polyclonal Antibody (orb331279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_683766
Preservative
Lyophilized powder
AA Sequence
SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ID2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C3]](https://cdn.genprice.uk/products/937/68dd1b64061270361ea13869/imageurl/ta500183am.webp)
TA500183AM 100 µL
ID2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C3]
Sign In for Pricing
View Details 
LY421650 100 µg
CCDC85A (NM_001080433) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC404119 20 µg
TRIAD3 (RNF216) (NM_207116) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC402635-100 1x 100 µL
Gastrin (GAST/2635), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details