Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSN1 Peptide - C-terminal region

DSN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf172, FLJ13346, KNL3, MGC32987, MIS13, dJ469A13.2, hKNL-3

UniProt

Q5JW55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSN1 Rabbit Polyclonal Antibody (orb586347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138789

Preservative

Lyophilized powder

AA Sequence

MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPLC Column, SiO2,10μm,120Å,4.6x250mm
13011967 1 PC

HPLC Column, SiO2,10μm,120Å,4.6x250mm

Sign In for Pricing
View Details
Human Cubilin (CUBN) ELISA Kit
abx573584-01 96 Tests

Human Cubilin (CUBN) ELISA Kit

Sign In for Pricing
View Details
Human Cubilin (CUBN) ELISA Kit
abx573584-02 5x 96 Tests

Human Cubilin (CUBN) ELISA Kit

Sign In for Pricing
View Details
Human Cubilin (CUBN) ELISA Kit
abx573584-03 10x 96 Tests

Human Cubilin (CUBN) ELISA Kit

Sign In for Pricing
View Details
2-tert-Butyl-4-thiazolecarboxylic Acid Ethyl Ester
419174-01 1 g

2-tert-Butyl-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
2-tert-Butyl-4-thiazolecarboxylic Acid Ethyl Ester
419174-02 10 g

2-tert-Butyl-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details