Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRL1 Peptide - C-terminal region

ADGRL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CL1, LEC2, CIRL1, LPHN1

UniProt

O94910

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRL1 Rabbit Polyclonal Antibody (orb586362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH07587

Preservative

Lyophilized powder

AA Sequence

YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Zika Virus IgG Antibody [DyLight 350]
NBP2-61133UV 0.1 mL

Rabbit Polyclonal Zika Virus IgG Antibody [DyLight 350]

Sign In for Pricing
View Details
Human Semaphorin 4F, SEMA4F ELISA KIT
E1565Hu-01 48 Well

Human Semaphorin 4F, SEMA4F ELISA KIT

Sign In for Pricing
View Details
Human Semaphorin 4F, SEMA4F ELISA KIT
E1565Hu-02 96 Well

Human Semaphorin 4F, SEMA4F ELISA KIT

Sign In for Pricing
View Details
Human Semaphorin 4F, SEMA4F ELISA KIT
E1565Hu-03 5x 96 Tests

Human Semaphorin 4F, SEMA4F ELISA KIT

Sign In for Pricing
View Details
Human Semaphorin 4F, SEMA4F ELISA KIT
E1565Hu-04 10x 96 Tests

Human Semaphorin 4F, SEMA4F ELISA KIT

Sign In for Pricing
View Details
Human MUC13 shRNA Plasmid
abx961166-01 150 µg

Human MUC13 shRNA Plasmid

Sign In for Pricing
View Details