Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRL1 Peptide - C-terminal region

ADGRL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CL1, LEC2, CIRL1, LPHN1

UniProt

O94910

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRL1 Rabbit Polyclonal Antibody (orb586362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH07587

Preservative

Lyophilized powder

AA Sequence

YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SUCNR1 siRNA
abx935617-01 15 nmol

Mouse SUCNR1 siRNA

Sign In for Pricing
View Details
Mouse SUCNR1 siRNA
abx935617-02 30 nmol

Mouse SUCNR1 siRNA

Sign In for Pricing
View Details
EIF2AK2 Antibody, HRP conjugated
A20341-100UL 100 µL

EIF2AK2 Antibody, HRP conjugated

Sign In for Pricing
View Details
RGP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39457061 1.0 µg DNA

RGP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sample Buffer Solution with 2-ME (2x) for SDS-PAGE
30566-22 25 mL

Sample Buffer Solution with 2-ME (2x) for SDS-PAGE

Sign In for Pricing
View Details
Amacr sgRNA CRISPR Lentivector (Rat) (Target 1)
K6896302 1.0 µg DNA

Amacr sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details