Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB4A Peptide - C-terminal region

RAB4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRES-1/RAB4, RAB4

UniProt

Q53GC2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB4A Rabbit Polyclonal Antibody (orb584405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004569

Preservative

Lyophilized powder

AA Sequence

VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EIF1B Protein
orb2995192-01 10 µg

Recombinant Human EIF1B Protein

Sign In for Pricing
View Details
Recombinant Human EIF1B Protein
orb2995192-02 50 µg

Recombinant Human EIF1B Protein

Sign In for Pricing
View Details
Recombinant Human EIF1B Protein
orb2995192-03 500 µg

Recombinant Human EIF1B Protein

Sign In for Pricing
View Details
Recombinant Human EIF1B Protein
orb2995192-04 1 mg

Recombinant Human EIF1B Protein

Sign In for Pricing
View Details
Rabbit anti-CD172a Antibody
YLD1398-01 50 µL

Rabbit anti-CD172a Antibody

Sign In for Pricing
View Details
Rabbit anti-CD172a Antibody
YLD1398-02 100 µL

Rabbit anti-CD172a Antibody

Sign In for Pricing
View Details