Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA4 Peptide - C-terminal region

LILRA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85g, ILT7, MGC129597, MGC129598

UniProt

P59901

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA4 Rabbit Polyclonal Antibody (orb586386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036408

Preservative

Lyophilized powder

AA Sequence

ATETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-365-3p miRNA Antagomir
abx889917-01 10 nmol

Rat rno-miR-365-3p miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-365-3p miRNA Antagomir
abx889917-02 20 nmol

Rat rno-miR-365-3p miRNA Antagomir

Sign In for Pricing
View Details
Copb2 (NM_021765) Rat Tagged ORF Clone Lentiviral Particle
RR213614L3V 200 µL

Copb2 (NM_021765) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) TRUD Polyclonal Antibody
MBS7174798 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) TRUD Polyclonal Antibody

Sign In for Pricing
View Details
AHSG protein (His tag)
80R-3410 50 ug

AHSG protein (His tag)

Sign In for Pricing
View Details
EPH B1 / 3 / 4 (pY778 / 792 / 774) Antibody
abx215188 100 µg

EPH B1 / 3 / 4 (pY778 / 792 / 774) Antibody

Sign In for Pricing
View Details