Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA4 Peptide - C-terminal region

LILRA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85g, ILT7, MGC129597, MGC129598

UniProt

P59901

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA4 Rabbit Polyclonal Antibody (orb586386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036408

Preservative

Lyophilized powder

AA Sequence

ATETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD116/CSF2RA, N-His
MBS1573441-01 0.1 mg

Recombinant Human CD116/CSF2RA, N-His

Sign In for Pricing
View Details
Recombinant Human CD116/CSF2RA, N-His
MBS1573441-02 1 mg

Recombinant Human CD116/CSF2RA, N-His

Sign In for Pricing
View Details
Recombinant Human CD116/CSF2RA, N-His
MBS1573441-03 5x 1 mg

Recombinant Human CD116/CSF2RA, N-His

Sign In for Pricing
View Details
CD4 Goat Polyclonal Antibody
TA348948 100 µg

CD4 Goat Polyclonal Antibody

Sign In for Pricing
View Details
DMRT2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18317064 1.0 µg DNA

DMRT2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FOXI3 Peptide
42-264P 0.1 mg

FOXI3 Peptide

Sign In for Pricing
View Details