Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G3 Peptide - C-terminal region

PLA2G3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIII-SPLA2, SPLA2III

UniProt

Q9NZ20

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G3 Rabbit Polyclonal Antibody (orb586269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056530

Preservative

Lyophilized powder

AA Sequence

QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primer Panel
HPP6002D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504679 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
trans-Cinnamoyl Chloride
TRC-C596290-5G 5 g

trans-Cinnamoyl Chloride

Sign In for Pricing
View Details
Galectin 1 (LGALS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]
TA810821AM 100 µL

Galectin 1 (LGALS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]

Sign In for Pricing
View Details
CD3E Human Gene Knockout Kit (CRISPR)
KN208276 1 Kit

CD3E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF405S conjugate, 0.1mg/mL
BNC042151-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details