Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G3 Peptide - C-terminal region

PLA2G3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIII-SPLA2, SPLA2III

UniProt

Q9NZ20

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G3 Rabbit Polyclonal Antibody (orb586269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056530

Preservative

Lyophilized powder

AA Sequence

QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]
AM06538SU-N 100 µL

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF647 conjugate, 0.1mg/mL
BNC471137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody
AN00300M-01 25 µL

Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody
AN00300M-02 100 µL

Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Human PRAMEF17 activation kit by CRISPRa
GA118192 1 Kit

Human PRAMEF17 activation kit by CRISPRa

Sign In for Pricing
View Details
CYP21A2 (NM_000500) Human Over-expression Lysate
LY424678 100 µg

CYP21A2 (NM_000500) Human Over-expression Lysate

Sign In for Pricing
View Details